PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 333aa    MW: 38220.4 Da    PI: 4.403
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.94e-11954146
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                    k i+n+  r++tf +R+ng+ KK +  S+  +a++++i++  +g++
  XP_004490182.1  9 KNINNEKVRKITFMNRKNGLTKKISDFSIKSGAKACLIVYDGDGNV 54
                    689*************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.03E-16175IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-10160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.657154IPR002100Transcription factor, MADS-box
CDDcd002661.67E-14274No hitNo description
PRINTSPR004042.8E-5323IPR002100Transcription factor, MADS-box
PfamPF003197.1E-121154IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAKVAIKN INNEKVRKIT FMNRKNGLTK KISDFSIKSG AKACLIVYDG DGNVAPTIWP  60
QDPTLVNSML QEYENQKIGT SPKIFDIKDY FKIKKEIVEA EILKVKKAIS RNKFPTWDPS  120
FNNMQVEHLT TFMETINAKV QDCNEKINMM KNIQEIETNF LHNTSHMQNM VPESVDSSNS  180
SQINVIQSIP QMEQYIHDPM ELPLDDVYEM VDLTNDVDLP PNSSTNQLCQ LVECDDLEVK  240
PINVCQLVEC DDLEVKPINV CQLVECDDLE VKPINERVNQ FADVDDWTNQ LDDDILNWIR  300
QPDQFSWKDI SFLPPSEHES ASLNALTQPK YGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490182.10.0PREDICTED: agamous-like MADS-box protein AGL16
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-14M-type_MADS family protein